PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30174.m008957
Common NameRCOM_1613700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family ARR-B
Protein Properties Length: 437aa    MW: 49118.4 Da    PI: 4.7987
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30174.m008957genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like73.82.4e-23204257155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kp+l Wt+eLH+rF++a++ L G++ A Pk+il++m+v+gL  e++ SHLQkYRl
  30174.m008957 204 KPKLIWTNELHDRFLQAIRIL-GIDSAHPKKILKHMNVPGLRKENISSHLQKYRL 257
                    79*******************.********************************8 PP

2Response_reg554.7e-19211271107
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    +l+vd + + + ++ ++l  +gy +v +a+ +++al++l+e++   Dlil+ + +p+md +ell++++e +  lpi++++a ++e+ +l +l  Ga
  30174.m008957  21 ILVVDCDSACLAIVSKMLYISGY-KVITAKRATDALHILRERQyeLDLILTEVHLPDMDKYELLETMAEVS-CLPIVILSADDDENAMLGCLFKGA 114
                    89*********************.***************9999889*********************9999.9*********************** PP

                    SEEEESS--HHHH CS
   Response_reg  95 kdflsKpfdpeel 107
                      +l Kp+ ++++
  30174.m008957 115 VFYLLKPITMNDV 127
                    ********98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23002.2E-2618142No hitNo description
SuperFamilySSF521723.56E-2419132IPR011006CheY-like superfamily
SMARTSM004487.2E-1719131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011030.62820135IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.5E-1521128IPR001789Signal transduction response regulator, receiver domain
CDDcd001567.86E-2022128No hitNo description
PROSITE profilePS512949.471201260IPR017930Myb domain
SuperFamilySSF466896.27E-18202261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-24203261IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-21204257IPR006447Myb domain, plants
PfamPF002493.6E-6209256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016310Biological Processphosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MRNEQVLSVD INAEGAAGVS ILVVDCDSAC LAIVSKMLYI SGYKVITAKR ATDALHILRE  60
RQYELDLILT EVHLPDMDKY ELLETMAEVS CLPIVILSAD DDENAMLGCL FKGAVFYLLK  120
PITMNDVKSL WQFSCVKNRK NNVATEGSHS YHGHSTPEIA SNEASECLSV LDTSQQNAQK  180
SEGKELQEMD KDEEATVTST FPKKPKLIWT NELHDRFLQA IRILGIDSAH PKKILKHMNV  240
PGLRKENISS HLQKYRLSLK REQEAIQKTM YRDDHYPPWN LETGTCEFLK AQFLMTRSQP  300
EFRSYAESQR NLHGCLTPVP SLGSANYHVQ LSSECDQINS NHSSCSQAGI RINNNEELES  360
FDQIRMNNVE NFGLEIASDG GIDILGNSSQ QQEQYLLPPL SPLPLVWEQQ EEDDDIFGAD  420
RAPRNDVSAG QKELVAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-17200261162ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015583138.10.0PREDICTED: two-component response regulator ARR14
TrEMBLB9RDJ90.0B9RDJ9_RICCO; Sensor histidine kinase, putative
STRINGPOPTR_0014s07320.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF145541114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.17e-51response regulator 2